Sermorelin is GHRH(1–29) amide, a 29-residue peptide. The supplied certificate names sermorelin acetate. The sequence interval, terminal amide and acetate description are separate parts of the identity.
The defined sermorelin reference
PubChem CID 16132413 records the 29-residue amidated peptide. The supplied report names its acetate form but does not print the complete sequence. The table labels the public molecular reference separately from that report.PubChem: Sermorelin, CID 16132413 (opens in a new tab)Sermorelin acetate 5 mg report: MA-SER-0032 (opens in a new tab)
| Field | Reference or document detail |
|---|---|
| Names | Sermorelin; GHRH(1–29) amide; GRF(1–29)-NH2 |
| CAS for the peptide reference | 86168-78-7 |
| Sequence | YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2 |
| Molecular formula | C149H246N44O42S, peptide reference |
| Molecular weight | 3357.9 g/mol, peptide reference |
| Supplied form named in report | Sermorelin acetate; acetate stoichiometry not printed |
Read length and termini independently
The earlier GHRH identity work distinguishes 44-, 40- and 37-residue forms. It describes an amidated 44-residue form and free carboxyl termini for the shorter 40- and 37-residue forms. This is useful naming context: residue count alone does not specify terminal chemistry.Esch et al. (1983), PMID 6130096 (opens in a new tab)
Sermorelin’s 1–29 interval and terminal amide identify its own fragment. A substitution also needs to remain visible: the [Nle27] notation in the cited analogue paper differs from methionine at position 27 in the sermorelin reference.PubChem: Sermorelin, CID 16132413 (opens in a new tab)Khorram et al. (1997), PMID 9141536 (opens in a new tab)
Match the acetate sample to its reference
Report MA-SER-0032, revision 01, identifies lot SER-32-7ET as GHRH(1–29) amide acetate and gives an LC-HRMS reference comparison. The full sequence and acetate stoichiometry are not printed. Keep those as specification questions instead of completing them from the short name.Sermorelin acetate 5 mg report: MA-SER-0032 (opens in a new tab)
The reported content and chromatographic area percentage are separate analytical results. A salt name or CAS reference does not replace the lot, report revision and identity-comparison details required for a document match.Sermorelin acetate 5 mg report: MA-SER-0032 (opens in a new tab)PubChem: Sermorelin, CID 16132413 (opens in a new tab)
Product and certificate checks
Sources and further detail
- Sermorelin acetate 5 mg report: MA-SER-0032 (opens in a new tab)
Supplied PDF re-read on 3 October 2026. Identity wording and document-specific results are transcribed; this is not independent authentication.
- PubChem: Sermorelin, CID 16132413 (opens in a new tab)
Existing identity record rechecked through PubChem formula, molecular-weight and synonym records on 3 October 2026. Values identify the peptide without an added acetate term.
- Esch et al. (1983), PMID 6130096 (opens in a new tab)
Existing donor source used only for peptide lengths and terminal chemistry.
- Khorram et al. (1997), PMID 9141536 (opens in a new tab)
Used only for the explicit position-27 substitution in the material name.
Revised 3 October 2026 using the existing source dossier and the specified primary identity records. Report values describe the linked samples. Products are for laboratory research use only.